Filtyp
The Urban Systems and Dynamics group, led by Prof. Nik, advances the boundaries of Building Physics to explore the complex interactions between buildings, urban systems, and climate. Our research focuses on designing and optimizing strategies for buildings and urban systems (with a big focus on energy systems) that drive the sustainable urban transition and enhance the built environment's resilien
The tendency to buy expensive and unnecessary goods is a pattern of consumer behavior that is becoming all too common in our society. We consume luxury items to satisfy practical needs that are already satisfied in the quest toward self-fulfillment, or simply to impress those around us. The phenomenon of “status consumption” has become increasingly evident in modern society. Although conspicuous c
Äldre män vinner mest på elskoter – Vetenskap och Hälsa Hoppa till innehåll Vetenskap och hälsa Populärvetenskapligt om medicinsk forskning i Skåne Teman Podd Tidskrift Prenumerera Om webbplatsen Kontakt Sök Sök Äldre män vinner mest på elskoter 2015-02-06 ⚠️ Den här artikeln är mer än 5 år gammal. Nya forskningsrön kan ha tillkommit. Foto: Colourbox För äldre män medför tillgången till elrullstol
https://www.vetenskaphalsa.se/aldre-man-vinner-mest-pa-elskoter/ - 2026-07-07
Botswana has figured widely as the exceptional African growth success story and has been frequently cited in scholarship that supports the view that African and other less developed economies are capable of rapid economic growth as long as the internal institutional framework and development policies are right. A shortcoming of the literature on African economic performance to date is that it has
Forskningen bedrivs vid avdelningen för infektionsmedicin på BMC i nära samarbete med avdelningen för reumatologi och fokuserar kring nya mekanismer hos neutrofiler (en slags vita blodkroppar) som kan förklara eller prognosticera infektionssjukdom eller infektionskänslighet. Projekten drivs både som translationella studier där vi försöker förklara mekanismerna varför infektionssjukdom uppträder hoOur research is conducted at the division of infection medicine at BMC in close collaboration with the division of rheumatology. The research is focused on new neutrophil mechanisms that can explain or prognosticate infectious diseases. The approach to the projects is either translational, where we try to explain why certain individuals turn ill due to infections, or more clinically focused, where
The Official records of the Swedish Foreign Ministry and War Ministry clearly indicate that the Stockholm was fully aware of the ongoing massacres and deportations of the Armenian subjects in the Ottoman Empire in an intentional annihilation of the Armenian nation.
Monte Carlo Calculations in Nuclear Medicine: Applications in Diagnostic Imaging - First edition Eds. M Ljungberg; S-E Strand, Lund University Hospital, Sweden; M A King, University of Massachussetts Medical School, Worcester, USA Covers the applications of Monte Carlo calculations (MC) in nuclear medicine from first principles, to the current computer applications. Written for nuclear medicine ph
https://www.msf.lu.se/research/simind-monte-carlo-program/literature - 2026-07-07
The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka
Migratory land birds perform extreme endurance flights when crossing ecological barriers, such as deserts, oceans and ice-caps. When travelling over benign areas, birds are expected to migrate by shorter flight steps, since carrying the heavy fuel loads needed for long non-stop flights comes at considerable cost. Here, we show that great snipes Gallinago media made long and fast non-stop flights (
Group exhibition.'The horizon is always receding' brings together a selection of works that reflect on the scope and the implications that the term contemporary may have. As the philosopher Giorgio Agamben suggests, contemporaneity can be understood as a term that surpasses temporal demarcations and transcends simultaneity and coexistence. In this sense, this exhibition serves as a symptomatic dis
Uppsatsen har undersökt huruvida spelföretaget Star Stable Entertainment AB marknadsföring av virtuella valutor och produkter till barn bryter mot EU:s konsumentskyddslagstiftning i ljuset av Sveriges Konsumenters anmälan mot företaget. Uppsatsen har även diskuterat om direktivet om otillbörliga affärs-metoder är anpassat för den digitala miljön med hänsyn till kommissionens aktuella fitness checkThe essay analyses whether the gaming company Star Stable Entertainment AB´s marketing of virtual currencies and other virtual products against chil-dren violates EU consumer law, considering the Swedish Consumers Associ-ation’s complaint against the company. The paper also discusses whether the Unfair Commercial Practice Directive (UCPD) is fit for the digital environ-ment, given the European Com
Staben samordnar och utvecklar Lunds universitetets ekonomimodell, förvaltar och utvecklar de IT-system som sektionen Ekonomi ansvarar för. Samordnar och utvecklar sektionens stöd i form av utbildning, information och support. Utvecklar och ansvarar för konsolidering av universitetets totalbudget samt ekonomiska uppföljning och analys. Ger stöd och råd i budget och uppföljningsfrågor. Leder och u
Forskningen inom avdelningen för Elektromagnetism och Nanoelektronik spänner över ett bredd områden från teoretisk elektroteknik och vågutbredning till nanoelektroniska komponenter och system. Tematiskt är forskningsområden indelade i 6 områden: Antenner och vågor, Metamaterial, Nanoelektronik för IoT, neuromorfa elektronik, kvantteknologi, THz och Kraftelektronik. Inom elektromagnetismen läggs sThe research within the Division of Electromagnetism and Nanoelectronics spans a wide range of areas from Electromagnetic Theory and wave propagation to nanoelectronic devices and systems. Thematically, research areas are divided into 6 areas: antennas and waves, metamaterials, nanoelectronics for IoT, neuromorphic computing, quantum technology, THz and Power electronics. Within the electromagnet
• Utveckla och ansvara för universitetets ekonomiska redovisning samt identifiera förbättringsmöjligheter för en rationell ekonomiadministration • Ge stöd, rådgivning, utbildning och information i ekonomi- och systemhanteringsfrågor • Upprätta myndighetens finansiella bokslut och ekonomisk rapportering till ledningen och andra intressenter • Kvalitetssäkra bokföringen • Hantera kund- och leverantö• To develop and take responsibility for the University’s accounting and to identify opportunities for improvement to rationalise financial administration • To provide support, advice, training and information on financial and systems management • To produce the public authority’s financial statements and financial reporting for the management and other stakeholders • Quality assurance of accou
Fokus för forskningen är språkutveckling hos barn med språkstörning och barn med typisk utveckling, som gjorts i samarbete med tidigare doktorander och magisterstudenter. Följande språkliga domäner har studerats: fonologi (uttal och satsmelodi), grammatik och ordförråd. De senaste decennierna har fokus legat på pragmatisk förmåga och barns förmåga till interaktion med sin omgivning, där även barn The research focus is language development in children with language impairment and with typical development, carried out in cooperation with earlier doctoral and master students. The following language domains have been studied: phonology, grammar and lexicon. In later years, focus has been on pragmatic and interactional aspects, also in children with ADHD, autism spectrum disorders and cerebral
Vid avdelningen för Tillämpad Biokemi bedrivs forskning inom både den grundläggande biokemin samt inom skilda biotekniska tillämpningar, ofta med industriella partners. Avdelningen ingår i flera nationella och internationella nätverk. Till våra huvudområden hör: enzymologi med protein engineering, växtbioteknik med metabolic engineering, uppreningsteknik för biomolekyler, biosensor-teknologi, milj
