Sökresultat

Ämnet Urban design och urbanism handlar om undervisning och forskning som rör stadsplanering och utformning av det offentliga rummet, där ämnet vill verka för en hållbar utveckling. Här ingår bland annat lärare från Masterprogram för hållbar stadsgestaltning (SUDes). Forskningen inom ämnet handlar framför allt om studier av stadsrummet och dess möjligheter. Vidare studeras frågor om social segreThe subject of Urban Design and Urbanism is concerned with teaching and research about city planning and the shaping of the public realm, with a focus on sustainable development. Members of staff from the Master's programme for Sustainable Urban Design are among those who teach on the subject. Research in the subject is primarily concerned with studies of urban spaces and their potential. Additi

https://www.thm.lu.se/internt/staff/when-you-are-away-work - 2026-05-09

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Forskningen bedrivs vid avdelningen för infektionsmedicin på BMC i nära samarbete med avdelningen för reumatologi och fokuserar kring nya mekanismer hos neutrofiler (en slags vita blodkroppar) som kan förklara eller prognosticera infektionssjukdom eller infektionskänslighet. Projekten drivs både som translationella studier där vi försöker förklara mekanismerna varför infektionssjukdom uppträder hoOur research is conducted at the division of infection medicine at BMC in close collaboration with the division of rheumatology. The research is focused on new neutrophil mechanisms that can explain or prognosticate infectious diseases. The approach to the projects is either translational, where we try to explain why certain individuals turn ill due to infections, or more clinically focused, where

Sub-cellular biological components are complex systems that work together to control and maintain cellular activity and health. It is useful to study the basic elements that constitute the sub-cellular components using model systems, which mimic certain parts of the overall system, in order to better understand the system as a whole. Here we present a number of tools, which enable the study of a f

Bertil Johansson är forskargruppsledare för forskargruppenBertil Johansson is Research Group Leader for this research group

In 2009, a nationwide initiative was established in order to lead and develop world-leading research in Sweden. Lund University received strategic research funding from the Swedish Foundation for Stategic Research and the Swedish Government for 12 strategic research areas (SRAs) of excellence. Of these 12 SRAs, StemTherapy (the strategic research area for Stem Cells and Regenerative Medicine) cont

MILJÖVETENSKAP Schema 171027 Kurs: MVET01 Kursansvarig: Charlotte Leire Lärare: Charlotte Leire, Julia Nussholz, Katherine Whalen, Philip Peck och Torbjörn Brorson. Gästföreläsare: Åke Thidell, Christina Windmark, Martin Kurdve, Murat Mirata, Anna Bruun Månsson, Lars Strupeit och Alexander Lidgren. Lokaler: Ekologihuset och till viss del IIIEE Litteratur: Se läslistor på LUVIT Studieteknik: Läs om

https://www.cec.lu.se/sv/sites/cec.lu.se.sv/files/schema_mv01_ht17_final.pdf - 2026-05-09

https://www.soclaw.lu.se/evenemang/phd-seminar-hera-muhires-final-seminar - 2026-05-09

The Urban Systems and Dynamics group, led by Prof. Nik, advances the boundaries of Building Physics to explore the complex interactions between buildings, urban systems, and climate. Our research focuses on designing and optimizing strategies for buildings and urban systems (with a big focus on energy systems) that drive the sustainable urban transition and enhance the built environment's resilien