Sökresultat

Fokus för forskningen är språkutveckling hos barn med språkstörning och barn med typisk utveckling, som gjorts i samarbete med tidigare doktorander och magisterstudenter. Följande språkliga domäner har studerats: fonologi (uttal och satsmelodi), grammatik och ordförråd. De senaste decennierna har fokus legat på pragmatisk förmåga och barns förmåga till interaktion med sin omgivning, där även barn The research focus is language development in children with language impairment and with typical development, carried out in cooperation with earlier doctoral and master students. The following language domains have been studied: phonology, grammar and lexicon. In later years, focus has been on pragmatic and interactional aspects, also in children with ADHD, autism spectrum disorders and cerebral

Vid avdelningen för Tillämpad Biokemi bedrivs forskning inom både den grundläggande biokemin samt inom skilda biotekniska tillämpningar, ofta med industriella partners. Avdelningen ingår i flera nationella och internationella nätverk. Till våra huvudområden hör: enzymologi med protein engineering, växtbioteknik med metabolic engineering, uppreningsteknik för biomolekyler, biosensor-teknologi, milj

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Uppsatsen har undersökt huruvida spelföretaget Star Stable Entertainment AB marknadsföring av virtuella valutor och produkter till barn bryter mot EU:s konsumentskyddslagstiftning i ljuset av Sveriges Konsumenters anmälan mot företaget. Uppsatsen har även diskuterat om direktivet om otillbörliga affärs-metoder är anpassat för den digitala miljön med hänsyn till kommissionens aktuella fitness checkThe essay analyses whether the gaming company Star Stable Entertainment AB´s marketing of virtual currencies and other virtual products against chil-dren violates EU consumer law, considering the Swedish Consumers Associ-ation’s complaint against the company. The paper also discusses whether the Unfair Commercial Practice Directive (UCPD) is fit for the digital environ-ment, given the European Com

Group exhibition.'The horizon is always receding' brings together a selection of works that reflect on the scope and the implications that the term contemporary may have. As the philosopher Giorgio Agamben suggests, contemporaneity can be understood as a term that surpasses temporal demarcations and transcends simultaneity and coexistence. In this sense, this exhibition serves as a symptomatic dis

Stefan Karlsson är forskargruppsledare för forskargruppenStefan Karlsson is Research Group Leader for this research group

Redovisning- och finansieringsområdet omfattar forskning inom ett brett fält från ekonomi- och verksamhetsstyrning, redovisning, revision, finansiell kommunikation, bolagsstyrning till forskning om företagsfinansiering, riskhantering och investerarrelationer.The accounting and corporate finance research covers a broad field from management accounting and control, financial accounting, financial communication and sustainability reporting to corporate governance, corporate financing, corporate risk management and investor relations.

Charlotta Böiers är forskargruppsledare för den här forskargruppenCharlotta Böiers is Research Group Leader for this research group

Forskargruppen arbetar med frågor som rör social inkludering/exkludering, transport - och mobilitetsrättvisa. Forskningen belyses utifrån olika perspektiv, såsom: urban/rural mobilitet, tillgänglighet för alla, sociala konsekvensanalyser, kollektivtrafik från ett användarperspektiv, deltagande metoder, sociala effekter, trygghet, transportfattigdom samt genus och intersektionalitet.The research group deals with issues of social inclusion/exclusion and mobility justice. The activities cover subjects such as: urban/rural mobility accessibility for all everyday life social impact assessment public transport from a user perspective participatory methods social effects associated with transport policies and infrastructure investments and transport disadvantage.

Avdelningen för miljö- och energisystem är en tvärvetenskaplig forskningsmiljö med rötter i Miljövårdsprogrammet vid Lunds universitet som bildades 1969. 1987 blev vi en egen institution och 2000 blev vi en avdelning inom Institutionen för Teknik och samhälle.  Forskningen började med kritiska energisystem studier på 1970- och 80-talet som visade på alternativ till de då tillförselorienterade ochThe Division of Environmental and Energy System Studies is an interdisciplinary research group with roots from the “Environmental program” established at Lund University in 1969. The research began with critical energy systems studies in the 1970s of the then supply-oriented and fossil- and nuclear dominated energy systems in Sweden and the world. Today, we mainly do interdisciplinary energy sys

Forskargruppen Ekologisk och evolutionär fysiologi studerar de mekanismer som påverkar avvägningen mellan reproduktion och överlevnad hos olika fåglar. Blåmesen, till exempel, investerar i många ungar och lever därför kortare tid. Havsörnen, däremot, satsar på att leva länge och får då inte så många ungar.The research group Ecological and Evolutionary Physiology studies physiological and ecological mechanisms affecting the balance between reproduction and survival. This involves both special adaptations and evolutionary constraints. Birds such as the blue tit invest in many offspring and have shorter lifespans, while the white-tailed eagle invests in a long lifespan and fewer offspring.

The Department of Biochemistry and Structural Biology was created in 2010 after the merger of the Department of Biochemistry and the Department of Molecular Biophysics. The focus of research at the new Department is within some major areas of modern biochemistry and molecular biology. These include membrane protein structure and function; enzyme structure and function; molecular interactions and m

Migratory land birds perform extreme endurance flights when crossing ecological barriers, such as deserts, oceans and ice-caps. When travelling over benign areas, birds are expected to migrate by shorter flight steps, since carrying the heavy fuel loads needed for long non-stop flights comes at considerable cost. Here, we show that great snipes Gallinago media made long and fast non-stop flights (

Avdelningen arbetar med att skapa hållbara strukturer, processer och styrdokument inom berörda processområden vid Lunds universitet: arbetsmiljö, hälsa, lika villkor, kompetensförsörjning och kompetensutveckling. Avdelningen är ett stöd till universitetsledningen i arbetsgivarpolitiska ställningstaganden, vägleder, utbildar och genomför insatser inom avdelningens huvudområden utifrån gällande regeThe Division works on creating sustainable structures, processes and regulatory documents in relevant process areas at Lund University: work environment, health, equal opportunities, provision of expertise, and professional development. The Division acts as support for the University Management regarding decision-making in employer policy matters, provides guidance and training, and carries out in

Unhealthful lifestyles underpin much of the burden of cardiometabolic disease affecting contemporary societies. Our overarching objective is to discover and optimise measurable biomarkers that can be used to stratify patient populations into subgroups that can be treated more effectively with targeted lifestyle therapies, at lesser cost and with fewer adverse events than conventional approaches

Karin Broberg är forskargruppsledare för den här forskargruppenKarin Broberg is Research Group Leader for this research group

Forskargruppen som leds av professor Kristina Sundquist är baserad inom ett dynamiskt forskningsinstitut, CPF (Centrum för Primärvårdsforskning) som grundades på fyra pelare: klinisk, epidemiologisk, samhällsvetenskaplig och experimentell forskning. Den forskning som gruppen utför är både klinisk och epidemiologisk, och dess huvudsakliga fokus är att besvara frågor relevanta för primärvården. ViktThe research group led by Professor Kristina Sundquist is based within a dynamic research institute, the CPF (Center for Primary Health Care Research) that was founded on four pillars: clinical, epidemiologic, social science, and experimental research. The research performed by the group is both clinical and epidemiologic, and its main focus is to answer primary health care-related questions. Key